PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_139720_hfgn.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 259aa    MW: 30269.3 Da    PI: 9.8135
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_139720_hfgn.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.72.1e-30959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+nrqvtfskRr g+ KKA+E+SvLCdaeva+iifs++gkl+eyss
  Bv6_139720_hfgn.t1  9 KRIENKINRQVTFSKRRSGLVKKAHEISVLCDAEVALIIFSHRGKLFEYSS 59
                        79***********************************************96 PP

2K-box103.23.3e-348417410100
               K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                         +   + +++ ++akLk+++e Lqr++Rh+lG++L+sL++keLq+LeqqL+++lk++Rs+Kn+l++e+i+elqkke+++qe+n+ L+kk++e
  Bv6_139720_hfgn.t1  84 DPDSQVNWTFDFAKLKAKLELLQRNHRHYLGQELDSLNMKELQSLEQQLDTALKNVRSRKNQLMHESISELQKKERAMQEHNNILSKKIKE 174
                         4455679*********************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.38161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.19E-34291IPR002100Transcription factor, MADS-box
CDDcd002651.40E-41276No hitNo description
PRINTSPR004043.2E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.9E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.9E-2886172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.17488178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009933Biological Processmeristem structural organization
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLVK KAHEISVLCD AEVALIIFSH RGKLFEYSSD  60
SSMEKILERY ERYSYAERRL ASNDPDSQVN WTFDFAKLKA KLELLQRNHR HYLGQELDSL  120
NMKELQSLEQ QLDTALKNVR SRKNQLMHES ISELQKKERA MQEHNNILSK KIKERGKNLE  180
QVQQMQWQNQ HQHQHQQQPP PPPQNHQVPP DASNFMLPPP IPSLNTGGYQ GQFGGEVRRN  240
DLDLTLEPIY SCHMGCFTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q6e-22174173Myocyte-specific enhancer factor 2B
1tqe_R6e-22174173Myocyte-specific enhancer factor 2B
1tqe_S6e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00096ChIP-seqTransfer from AT1G69120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010681126.10.0PREDICTED: truncated transcription factor CAULIFLOWER A
SwissprotQ412761e-114AP1_SINAL; Floral homeotic protein APETALA 1
TrEMBLA0A0J8C8W80.0A0A0J8C8W8_BETVU; Uncharacterized protein
STRINGVIT_01s0011g00100.t011e-121(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.14e-97MIKC_MADS family protein